MRPL50 Peptide - N-terminal region
MRPL50 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MRP-L50
UniProt
Q8N5N7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPL50 Rabbit Polyclonal Antibody (orb583521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061924
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2168-100 1x 100 µL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![AGO1 Mouse Monoclonal Antibody [Clone ID: OTI3F5]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a81/imageurl/cf811172.webp)
![PTH1R Recombinant Rabbit Monoclonal Antibody [JE36-10]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea8125d/imageurl/ha721716.webp)
HA721716 100 µL
PTH1R Recombinant Rabbit Monoclonal Antibody [JE36-10]
Sign In for Pricing
View Details 
