Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR11 Peptide - C-terminal region

PRR11 Peptide - C-terminal region

Product Specifications

UniProt

D2SNZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRR11 Rabbit Polyclonal Antibody (orb581292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060774

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLPLSTSSFDEQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT1A7 Polyclonal Antibody, PE-Cy7 Conjugated
bs-20068R-PE-Cy7 100 µL

UGT1A7 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit
DLR-XCL2-Hu-96T 96 Tests

Human Chemokine C-Motif Ligand 2 (XCL2) ELISA Kit

Sign In for Pricing
View Details
FMR1 Peptide
46-842P 0.1 mg

FMR1 Peptide

Sign In for Pricing
View Details
Human ZNF735 Pre-designed siRNA Set B
SI019043B 1 Each

Human ZNF735 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-UHRF1 Antibody Picoband®
A01156-1 100 µg/Vial

Anti-UHRF1 Antibody Picoband®

Sign In for Pricing
View Details
Carbonic anhydrase inhibitor 32
T207684-01 10 mg

Carbonic anhydrase inhibitor 32

Sign In for Pricing
View Details