Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR11 Peptide - C-terminal region

PRR11 Peptide - C-terminal region

Product Specifications

UniProt

D2SNZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRR11 Rabbit Polyclonal Antibody (orb581292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060774

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLPLSTSSFDEQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-SERCA1 Antibody
YLD7077-01 50 µL

Rabbit anti-SERCA1 Antibody

Sign In for Pricing
View Details
Rabbit anti-SERCA1 Antibody
YLD7077-02 100 µL

Rabbit anti-SERCA1 Antibody

Sign In for Pricing
View Details
IL4 Antibody
ASA-B1024 1 Each

IL4 Antibody

Sign In for Pricing
View Details
C-Undecylcalix[4]resorcinarene monohydrate
FU62103-01 0.1 g

C-Undecylcalix[4]resorcinarene monohydrate

Sign In for Pricing
View Details
C-Undecylcalix[4]resorcinarene monohydrate
FU62103-02 0.25 g

C-Undecylcalix[4]resorcinarene monohydrate

Sign In for Pricing
View Details
C-Undecylcalix[4]resorcinarene monohydrate
FU62103-03 0.5 g

C-Undecylcalix[4]resorcinarene monohydrate

Sign In for Pricing
View Details