C1ORF61 Peptide - N-terminal region
C1ORF61 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CROC4
UniProt
Q13536
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C1ORF61 Rabbit Polyclonal Antibody (orb575271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_006711182
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15392502 1 Vial
Lentiviral human RBM23 sgRNA gene knockout kit - Lentiviral human RBM23 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details 1070-2805 4800 Tips
300 uL, LTS compatible tips for Rainin pipettes, non-filter, rack, non-sterile, low retention, case of 5 (4800 tips in 50 racks)
Sign In for Pricing
View Details