Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF8 Peptide - C-terminal region

SLAMF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BLAME, CD353, SBBI42

UniProt

Q9P0V8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLAMF8 Rabbit Polyclonal Antibody (orb327275) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_064510

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPLVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMKIV (CAMK4) (NM_001744) Human Over-expression Lysate
LC400661 20 µg

CAMKIV (CAMK4) (NM_001744) Human Over-expression Lysate

Sign In for Pricing
View Details
Piperlongumine
SIH-156-100MG 100 mg

Piperlongumine

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF488A conjugate, 0.1mg/mL
BNC882148-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MDM1 activation kit by CRISPRa
GA111243 1 Kit

Human MDM1 activation kit by CRISPRa

Sign In for Pricing
View Details
JKAMP (NM_001098625) Human Over-expression Lysate
LY420648 100 µg

JKAMP (NM_001098625) Human Over-expression Lysate

Sign In for Pricing
View Details
THSD7B Human Gene Knockout Kit (CRISPR)
KN417143 1 Kit

THSD7B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details