Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORMDL2 Peptide - N-terminal region

ORMDL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MST095, HSPC160, MSTP095, adoplin-2

UniProt

Q53FV1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_054901.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OxiSelect™ In Vitro Nitric Oxide (Nitrite / Nitrate) Assay Kit (Colorimetric)
STA-802-5 5x 100 Assays

OxiSelect™ In Vitro Nitric Oxide (Nitrite / Nitrate) Assay Kit (Colorimetric)

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii 3-ketodihydrosphingosine reductase TSC10 (TSC10), partial
MBS7085870 Inquire

Recombinant Debaryomyces hansenii 3-ketodihydrosphingosine reductase TSC10 (TSC10), partial

Sign In for Pricing
View Details
Mouse Monoclonal Chordin-like 2/CHRDL2 Antibody (272905) [PerCP]
FAB24481C 0.1 mL

Mouse Monoclonal Chordin-like 2/CHRDL2 Antibody (272905) [PerCP]

Sign In for Pricing
View Details
Anti-Valproic Acid Antibody
orb1148007-01 100 µg

Anti-Valproic Acid Antibody

Sign In for Pricing
View Details
Anti-Valproic Acid Antibody
orb1148007-02 500 µg

Anti-Valproic Acid Antibody

Sign In for Pricing
View Details
Anti-Valproic Acid Antibody
orb1148007-03 1 mg

Anti-Valproic Acid Antibody

Sign In for Pricing
View Details