Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX3 Peptide - N-terminal region

SNX3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDP3, Grd19, MCOPS8

UniProt

O60493

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001287858.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM64B CRISPRa sgRNA lentivector (set of three targets)(Human)
47833121 3x 1.0µg DNA

TRIM64B CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
MRPS6 Rabbit Polyclonal Antibody
orb155146 100 µg

MRPS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CBX7 Mouse mAb
orb2717078-01 50 µL

CBX7 Mouse mAb

Sign In for Pricing
View Details
CBX7 Mouse mAb
orb2717078-02 100 µL

CBX7 Mouse mAb

Sign In for Pricing
View Details
CCDC90A Rabbit Polyclonal Antibody (FITC)
orb2118762 100 µL

CCDC90A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
LineGene 9600 Pro Fluorescent Quantitative Detection System
BYQ6A56E 1 Unit

LineGene 9600 Pro Fluorescent Quantitative Detection System

Sign In for Pricing
View Details