Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC90A Rabbit Polyclonal Antibody (FITC)

CCDC90A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FMP32, C6orf79, CCDC90A

UniProt

Q96AQ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCDC90A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo30 (NM_001168297) Mouse Tagged Lenti ORF Clone
MR215647L4 10 µg

Fbxo30 (NM_001168297) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KIF1B (Kinesin Family Member 1B, KLP, CMT2, CMT2A, CMT2A1, HMSNII, NBLST1) (MaxLight 750)
MBS6447425-01 0.1 mL

KIF1B (Kinesin Family Member 1B, KLP, CMT2, CMT2A, CMT2A1, HMSNII, NBLST1) (MaxLight 750)

Sign In for Pricing
View Details
KIF1B (Kinesin Family Member 1B, KLP, CMT2, CMT2A, CMT2A1, HMSNII, NBLST1) (MaxLight 750)
MBS6447425-02 5x 0.1 mL

KIF1B (Kinesin Family Member 1B, KLP, CMT2, CMT2A, CMT2A1, HMSNII, NBLST1) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Rat Cardiotrophin-1 protein (Ctf1), Active Protein
RPC29134-01 Inquire

Recombinant Rat Cardiotrophin-1 protein (Ctf1), Active Protein

Sign In for Pricing
View Details
Recombinant Rat Cardiotrophin-1 protein (Ctf1), Active Protein
RPC29134-02 100 µg

Recombinant Rat Cardiotrophin-1 protein (Ctf1), Active Protein

Sign In for Pricing
View Details
CD3 epsilon Antibody HRP Conjugated
MBS9460039-01 0.1 mL

CD3 epsilon Antibody HRP Conjugated

Sign In for Pricing
View Details