Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTRF1L Peptide - N-terminal region

MTRF1L Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRF1L, HMRF1L, mtRF1a

UniProt

Q9UGC7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTRF1L Rabbit Polyclonal Antibody (orb55699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107656

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Probenecid, Sodium Salt *Water Soluble*, 10x77mg
#50027 10x 77 mg

Probenecid, Sodium Salt *Water Soluble*, 10x77mg

Sign In for Pricing
View Details
SPRR2E (NM_001024209) Human Over-expression Lysate
LC422617 20 µg

SPRR2E (NM_001024209) Human Over-expression Lysate

Sign In for Pricing
View Details
Purified Anti-Mouse CD120b/TNFR2 Antibody[TR75-54.7]
E-AB-F1035A-01 25 µg

Purified Anti-Mouse CD120b/TNFR2 Antibody[TR75-54.7]

Sign In for Pricing
View Details
Purified Anti-Mouse CD120b/TNFR2 Antibody[TR75-54.7]
E-AB-F1035A-02 100 µg

Purified Anti-Mouse CD120b/TNFR2 Antibody[TR75-54.7]

Sign In for Pricing
View Details
1,2,3,4,7,8,9-Heptachlorodibenzofuran
TRC-H265085-1MG 1 mg

1,2,3,4,7,8,9-Heptachlorodibenzofuran

Sign In for Pricing
View Details
DELE1 (NM_001142603) Human Over-expression Lysate
LC428204 20 µg

DELE1 (NM_001142603) Human Over-expression Lysate

Sign In for Pricing
View Details