Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAN3 Peptide - middle region

PAN3 Peptide - middle region

Product Specifications

UniProt

Q58A45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAN3 Rabbit Polyclonal Antibody (orb589276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787050.6

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF37 Rabbit Polyclonal Antibody (FITC)
orb2086905 100 µL

ARHGEF37 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human RNF217 Pre-designed siRNA Set A
SI013889A 1 Each

Human RNF217 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RPL22 Peptide - C-terminal region
orb2009152 100 µg

RPL22 Peptide - C-terminal region

Sign In for Pricing
View Details
Septin 3 (SEPT3)
333745-01 50 µg

Septin 3 (SEPT3)

Sign In for Pricing
View Details
Septin 3 (SEPT3)
333745-02 100 µg

Septin 3 (SEPT3)

Sign In for Pricing
View Details
Phospho-TAK1 (Ser439) Antibody [F17C11]
C20201-50uL 50 μL

Phospho-TAK1 (Ser439) Antibody [F17C11]

Sign In for Pricing
View Details