SERPINB2 Peptide - middle region
SERPINB2 Peptide - middle region
Product Specifications
Product Name Alternative
PAI, PAI2, PAI-2, PLANH2, HsT1201
UniProt
P05120
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERPINB2 Rabbit Polyclonal Antibody (orb588352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001137290.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A00187-2-FITC 100 µg/Vial
Anti-MUC1 Antibody Picoband®, FITC Conjugate
Sign In for Pricing
View Details 
124041-FITC 100 µL
BTG2 (Protein BTG2, BTG Family Member 2, PC3, NGF-inducible Anti-proliferative Protein PC3, MGC126063, MGC126064, TIS21) (FITC)
Sign In for Pricing
View Details 