What is the catalog number for SYNGR2 Peptide - middle region?

The catalog number for SYNGR2 Peptide - middle region is orb2001498.

What sizes are available for SYNGR2 Peptide - middle region?

SYNGR2 Peptide - middle region is available in the following size(s): 100 µg.

Is SYNGR2 Peptide - middle region in stock?

SYNGR2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SYNGR2 Peptide - middle region

Product Specifications

UniProt

O43760

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004701.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

134632-AP 100 µL

TPD52 (Tumor Protein D52, D52, hD52, PC-1, PrLZ, Protein N8, N8L) (AP) discontinued

Sign In for Pricing

View Details

375924-01 20 µg

Zona Occludens Toxin, Recombinant, Vibrio Cholerae Serotype O1, aa1-399, His-Tag (Zot)

Sign In for Pricing

View Details

375924-02 100 µg

Zona Occludens Toxin, Recombinant, Vibrio Cholerae Serotype O1, aa1-399, His-Tag (Zot)

Sign In for Pricing

View Details

13546161 1.0 µg

BTF3P3 AAV siRNA Pooled Vector

Sign In for Pricing

View Details

bs-4609R-Cy3 100 µL

CD105 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing

View Details

M1009-1 100 µL

FAM62B Mouse Monoclonal Antibody [C4-D0]

Sign In for Pricing

View Details