Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA13 Peptide - middle region

HSPA13 Peptide - middle region

Product Specifications

Product Name Alternative

STCH

UniProt

P48723

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA13 Rabbit Polyclonal Antibody (orb589332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_008879.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEI

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCB4 Peptide - middle region
orb2000551 100 µg

PLCB4 Peptide - middle region

Sign In for Pricing
View Details
ZNF8 Polyclonal Antibody
E-AB-52395-01 20 µL

ZNF8 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF8 Polyclonal Antibody
E-AB-52395-02 60 µL

ZNF8 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF8 Polyclonal Antibody
E-AB-52395-03 120 µL

ZNF8 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF8 Polyclonal Antibody
E-AB-52395-04 200 µL

ZNF8 Polyclonal Antibody

Sign In for Pricing
View Details
BTBD18 (BTB/POZ Domain-Containing Protein 18)
476413 100 µL

BTBD18 (BTB/POZ Domain-Containing Protein 18)

Sign In for Pricing
View Details