PLCB4 Peptide - middle region
PLCB4 Peptide - middle region
Product Specifications
Product Name Alternative
ARCND2, PI-PLC
UniProt
Q15147
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLCB4 Rabbit Polyclonal Antibody (orb589022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000924.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALAS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6167697-01 0.1 mL
UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (APC)
Sign In for Pricing
View Details 
MBS6167697-02 5x 0.1 mL
UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (APC)
Sign In for Pricing
View Details MBS9397118-01 48 Well
Camel Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 2 (DYRK2) ELISA Kit
Sign In for Pricing
View Details MBS9397118-02 96 Well
Camel Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 2 (DYRK2) ELISA Kit
Sign In for Pricing
View Details MBS9397118-03 5x 96 Well
Camel Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 2 (DYRK2) ELISA Kit
Sign In for Pricing
View Details MBS9397118-04 10x 96 Well
Camel Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 2 (DYRK2) ELISA Kit
Sign In for Pricing
View Details