Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATXN1 Peptide - N-terminal region

ATXN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATX1, SCA1, D6S504E

UniProt

P54253

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000323.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAWLPGNPGGRGHGGGRHGPAGTSVELGLQQGIGLHKALSTGLDYSPPSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF21A Polyclonal Antibody
E-AB-18538-01 20 µL

PHF21A Polyclonal Antibody

Sign In for Pricing
View Details
PHF21A Polyclonal Antibody
E-AB-18538-02 60 µL

PHF21A Polyclonal Antibody

Sign In for Pricing
View Details
PHF21A Polyclonal Antibody
E-AB-18538-03 120 µL

PHF21A Polyclonal Antibody

Sign In for Pricing
View Details
PHF21A Polyclonal Antibody
E-AB-18538-04 200 µL

PHF21A Polyclonal Antibody

Sign In for Pricing
View Details
ARHGAP1 Human Gene Knockout Kit (CRISPR)
KN401966 1 Kit

ARHGAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biological Microscope BMIC-205-B
BMIC-205-B Each

Biological Microscope BMIC-205-B

Sign In for Pricing
View Details