Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S1PR1 Peptide - C-terminal region

S1PR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EDG1, S1P1, CD363, ECGF1, EDG-1, CHEDG1, D1S3362

UniProt

P21453

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S1PR1 Rabbit Polyclonal Antibody (orb589651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001391.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calreticulin (CALR) Polyclonal Antibody
CAU31415-01 100 µL

Calreticulin (CALR) Polyclonal Antibody

Sign In for Pricing
View Details
Calreticulin (CALR) Polyclonal Antibody
CAU31415-02 200 µL

Calreticulin (CALR) Polyclonal Antibody

Sign In for Pricing
View Details
HDAC2 siRNA (r)
sc-270150 10 µM

HDAC2 siRNA (r)

Sign In for Pricing
View Details
PARP1 Rabbit Polyclonal Antibody (BF594)
orb1594048 100 µL

PARP1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
ACAT1 Antibody
orb1248597 0.1 mg

ACAT1 Antibody

Sign In for Pricing
View Details
HSP22 Mouse mAb, IRDye 800CW conjugated
orb2826779 100 µL

HSP22 Mouse mAb, IRDye 800CW conjugated

Sign In for Pricing
View Details