Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CELF2 Peptide - N-terminal region

CELF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ETR3, ETR-3, NAPOR, CELF-2, CUGBP2, BRUNOL3, CUG-BP2

UniProt

O95319

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CELF2 Rabbit Polyclonal Antibody (orb324847) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001313248

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LRG1 / Leucine-Rich Alpha-2-Glycoprotein Recombinant Protein
MBS2903077 Inquire

Human LRG1 / Leucine-Rich Alpha-2-Glycoprotein Recombinant Protein

Sign In for Pricing
View Details
TRAM2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2440306 1.0 µg DNA

TRAM2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Pongo abelii Pre-mRNA-splicing factor CWC22 homolog (CWC22), partial
MBS1314755 Inquire

Recombinant Pongo abelii Pre-mRNA-splicing factor CWC22 homolog (CWC22), partial

Sign In for Pricing
View Details
Kctd3 Peptide - middle region
orb2010201 100 µg

Kctd3 Peptide - middle region

Sign In for Pricing
View Details
Rabbit Polyclonal CARD12 Antibody [Alexa Fluor 532]
NBP1-78979AF532 0.1 mL

Rabbit Polyclonal CARD12 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Purified recombinant Human TNFRSF17 protein (His tag)
MBS5308982-01 0.1 mg

Purified recombinant Human TNFRSF17 protein (His tag)

Sign In for Pricing
View Details