Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kctd3 Peptide - middle region

Kctd3 Peptide - middle region

Product Specifications

Product Name Alternative

4930438A20Rik, 9330185B06, E330032J19Rik, NY-REN-45

UniProt

Q8BFX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kctd3 Rabbit Polyclonal Antibody (orb575421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766238

Preservative

Lyophilized powder

AA Sequence

MKDNDLLVTELYHDPSNDAVTALSVYLTPKTSVSGNWIEIAYGTSSGAVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal IL-4 Antibody (BVD4-1D11) [DyLight 405]
NB100-64798V 0.25 mL

Rat Monoclonal IL-4 Antibody (BVD4-1D11) [DyLight 405]

Sign In for Pricing
View Details
FGF5 (Fibroblast Growth Factor 5, FGF-5, Heparin-binding Growth Factor 5, HBGF-5, Smag-82) (PE)
126783-PE 100 µL

FGF5 (Fibroblast Growth Factor 5, FGF-5, Heparin-binding Growth Factor 5, HBGF-5, Smag-82) (PE)

Sign In for Pricing
View Details
Collagen III Monoclonal Antibody (Q76)
BT-MCA0025-01 20 µL

Collagen III Monoclonal Antibody (Q76)

Sign In for Pricing
View Details
Collagen III Monoclonal Antibody (Q76)
BT-MCA0025-02 50 µL

Collagen III Monoclonal Antibody (Q76)

Sign In for Pricing
View Details
Collagen III Monoclonal Antibody (Q76)
BT-MCA0025-03 100 µL

Collagen III Monoclonal Antibody (Q76)

Sign In for Pricing
View Details
Cystatin C BioAssayTM ELISA Kit, Mouse
143803 96 Tests

Cystatin C BioAssayTM ELISA Kit, Mouse

Sign In for Pricing
View Details