Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIPK2 Peptide - middle region

RIPK2 Peptide - middle region

Product Specifications

Product Name Alternative

CCK, RICK, RIP2, CARD3, GIG30, CARDIAK

UniProt

O43353

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIPK2 Rabbit Polyclonal Antibody (orb589665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003812.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS (Melatonin Sulfate) Monkey ELISA Kit
F1068 96 Tests

MS (Melatonin Sulfate) Monkey ELISA Kit

Sign In for Pricing
View Details
SF4 Rabbit Polyclonal Antibody (HRP)
orb2124239 100 µL

SF4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
DIS3L Polyclonal Antibody
RD88496A-01 60 μL

DIS3L Polyclonal Antibody

Sign In for Pricing
View Details
DIS3L Polyclonal Antibody
RD88496A-02 120 μL

DIS3L Polyclonal Antibody

Sign In for Pricing
View Details
DIS3L Polyclonal Antibody
RD88496A-03 200 µL

DIS3L Polyclonal Antibody

Sign In for Pricing
View Details
PRDX3, NT (Thioredoxin-dependent Peroxide Reductase, Mitochondrial, Peroxiredoxin-3, Peroxiredoxin III, PRX III, Antioxidant Protein 1, AOP-1, Protein MER5 Homolog, HBC189, AOP1) (Biotin) discontinued
P3352-20B-Biotin 200 µL

PRDX3, NT (Thioredoxin-dependent Peroxide Reductase, Mitochondrial, Peroxiredoxin-3, Peroxiredoxin III, PRX III, Antioxidant Protein 1, AOP-1, Protein MER5 Homolog, HBC189, AOP1) (Biotin) discontinued

Sign In for Pricing
View Details