Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF4 Rabbit Polyclonal Antibody (HRP)

SF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RBP, SF4, F23858

UniProt

Q8IWZ8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_757386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)
MBS2113664-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)
MBS2113664-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)
MBS2113664-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)
MBS2113664-04 1 mL

Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)
MBS2113664-05 5 mL

Biotin-Linked Polyclonal Antibody to Cell Division Cycle Protein 16 (CDC16)

Sign In for Pricing
View Details
Na-Boc-Ng-xanthyl-L-asparagine Merrifield resin
240434-01 5 g

Na-Boc-Ng-xanthyl-L-asparagine Merrifield resin

Sign In for Pricing
View Details