Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC9 Peptide - middle region

ZDHHC9 Peptide - middle region

Product Specifications

Product Name Alternative

CGI89, DHHC9, MMSA1, MRXSZ, ZNF379, ZNF380, CXorf11, ZDHHC10

UniProt

Q9Y397

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZDHHC9 Rabbit Polyclonal Antibody (orb589561) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001008223.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATF-3 (Activating Transcription Factor 3) ELISA Kit
EH2676 96 Tests

Human ATF-3 (Activating Transcription Factor 3) ELISA Kit

Sign In for Pricing
View Details
Chpf Rat shRNA Lentiviral Particle (Locus ID 316533)
TL700711V 500 µL Each

Chpf Rat shRNA Lentiviral Particle (Locus ID 316533)

Sign In for Pricing
View Details
VPS35 Antibody, Clone 10A8: ATTO 488
MBS8005663-01 0.1 mg

VPS35 Antibody, Clone 10A8: ATTO 488

Sign In for Pricing
View Details
VPS35 Antibody, Clone 10A8: ATTO 488
MBS8005663-02 5x 0.1 mg

VPS35 Antibody, Clone 10A8: ATTO 488

Sign In for Pricing
View Details
Lass1
X2292B 50 µg

Lass1

Sign In for Pricing
View Details
NT5M (C-Term) Rabbit pAb
MBS8557846-01 0.1 mL

NT5M (C-Term) Rabbit pAb

Sign In for Pricing
View Details