CAPN6 Peptide - middle region
CAPN6 Peptide - middle region
Product Specifications
Product Name Alternative
CANPX, CAPNX, CalpM, DJ914P14.1
UniProt
Q9Y6Q1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CAPN6 Rabbit Polyclonal Antibody (orb589407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055104.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF
More Discoveries
Explore Other Products
Browse additional items from our catalog
N0600-06-PE 100 µL
Neisseria gonorrhoeae (Gonorrhea) (PE) discontinued
Sign In for Pricing
View Details 
K6048807 1.0 µg DNA
RGD1565096 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details RPC21462-01 20 µg
Recombinant Human Heme oxygenase 1 (HMOX1), partial
Sign In for Pricing
View Details RPC21462-02 100 µg
Recombinant Human Heme oxygenase 1 (HMOX1), partial
Sign In for Pricing
View Details RPC21462-03 1 mg
Recombinant Human Heme oxygenase 1 (HMOX1), partial
Sign In for Pricing
View Details