Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heme oxygenase 1 (HMOX1), partial

Recombinant Human Heme oxygenase 1 (HMOX1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HMOX1. Target Synonyms: 32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32. Accession Number: P09601. Expression Region: 3~288aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Heme oxygenase 1 (HMOX1), partial is a purified Recombinant Protein.

Accession Number

P09601

Expression Region

3~288aa

Host

E. coli

Target

HMOX1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAMP3 Antibody Blocking peptide
orb1455253 500 µg

RAMP3 Antibody Blocking peptide

Sign In for Pricing
View Details
Anti-BOULE  (1C3)
YF-MA19289 100 ug

Anti-BOULE (1C3)

Sign In for Pricing
View Details
DCP1B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
17738154 3x 1.0 µg DNA

DCP1B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
TWNK Polyclonal Antibody, FITC Conjugated
A69097-100 100 µL

TWNK Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Slfn9 shRNA (UAS) - Lentiviral mouse Slfn9 shRNA (UAS, iRFP) plasmid
GTR15297127 1 Vial

Lentiviral mouse Slfn9 shRNA (UAS) - Lentiviral mouse Slfn9 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Human Galectin-9 (LGALS9), partial
orb2986762-01 20 µg

Recombinant Human Galectin-9 (LGALS9), partial

Sign In for Pricing
View Details