Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTK Peptide - C-terminal region

FASTK Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAST

UniProt

Q14296

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTK Rabbit Polyclonal Antibody (orb589512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001245390.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQK

More Discoveries

Explore Other Products

Browse additional items from our catalog

NS 3763
TRC-N900568-0.5MG 0.5 mg

NS 3763

Sign In for Pricing
View Details
Rabbit Anti-Human AKR1A1 pAb
PA5219-01 50 μL

Rabbit Anti-Human AKR1A1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human AKR1A1 pAb
PA5219-02 100 μL

Rabbit Anti-Human AKR1A1 pAb

Sign In for Pricing
View Details
Anti-MYH10 Antibody (R1V13)
RHE13301 100 μg

Anti-MYH10 Antibody (R1V13)

Sign In for Pricing
View Details
IL28RA/IFNLR1, Human (HEK293, His)
HY-P705041 100 µg

IL28RA/IFNLR1, Human (HEK293, His)

Sign In for Pricing
View Details
Anti-Rt TCR gamma/delta PE
MBS1801674-01 0.1 mg

Anti-Rt TCR gamma/delta PE

Sign In for Pricing
View Details