Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL28RA/IFNLR1, Human (HEK293, His)

Product Specifications

Product Name Alternative

IL28RA/IFNLR1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA

Molecular Formula

163702 (Gene_ID) Q8IU57-1 (R21-A228) (Accession)

Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)
MBS1470244-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)
MBS1470244-02 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)
MBS1470244-03 0.02 mg (Yeast)

Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)
MBS1470244-04 0.1 mg (Yeast)

Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)
MBS1470244-05 0.02 mg (Baculovirus)

Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)
MBS1470244-06 0.02 mg (Mammalian-Cell)

Recombinant Synechococcus sp. Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details