SEMA6C Peptide - C-terminal region
SEMA6C Peptide - C-terminal region
Product Specifications
Product Name Alternative
SEMAY, m-SemaY, m-SemaY2
UniProt
Q9H3T2
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEMA6C Rabbit Polyclonal Antibody (orb585273) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001171532.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KDGDAVQTPQLYTTFLPPPEGVPPPELACLPTPESTPELPVKHLRAAGDP
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6230309-01 0.1 mL
TFEB (Transcription Factor EB, AlphaTFEB, TCFEB, bHLHe35) (MaxLight 650)
Sign In for Pricing
View Details 
MBS6230309-02 5x 0.1 mL
TFEB (Transcription Factor EB, AlphaTFEB, TCFEB, bHLHe35) (MaxLight 650)
Sign In for Pricing
View Details orb2902769-01 20 µg
Recombinant Chicken Integral membrane protein 2B (ITM2B)
Sign In for Pricing
View Details orb2902769-02 100 µg
Recombinant Chicken Integral membrane protein 2B (ITM2B)
Sign In for Pricing
View Details 