What sizes are available for Recombinant Chicken Integral membrane protein 2B (ITM2B)?

Recombinant Chicken Integral membrane protein 2B (ITM2B) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Chicken Integral membrane protein 2B (ITM2B) come in?

Recombinant Chicken Integral membrane protein 2B (ITM2B) is available in 2 different pack sizes.

Recombinant Chicken Integral membrane protein 2B (ITM2B)

Q: What is the catalog number for Recombinant Chicken Integral membrane protein 2B (ITM2B)?

The catalog number for Recombinant Chicken Integral membrane protein 2B (ITM2B) is orb2902769.

This Recombinant Chicken Integral membrane protein 2B (ITM2B) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Integral membrane protein 2B, Transmembrane protein E3-16

UniProt

O42204

Expression Region

1-262

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKVSFNSALAHKEAANKEEENSQVLILPPDAKEPEDVVVPAGHKRAWCWCMCFGLAFMLAGVILGGAYLYKYFAFQQGGVYFCGIKYIEDGLSLPESGAQLKSARYHTIEQNIQILEEEDVEFISVPVPEFADSDPADIVHDFHRRLTAYLDLSLDKCYVIPLNTSVVMPPKNFLELLINIKAGTYLPQSYLIHEQMIVTDRIENVDQLGFFIYRLCRGKETYKLQRKEAMKGIQKREAVNCRKIRHFENRFAMETLICEQ