SEC23A Peptide - middle region
SEC23A Peptide - middle region
Product Specifications
Product Name Alternative
CLSD
UniProt
Q15436
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC23A Rabbit Polyclonal Antibody (orb589866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006355.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RAETEEGPDVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
129955-ML405 100 µL
MTDH (Protein LYRIC, 3D3/LYRIC, Astrocyte Elevated gene-1 Protein, AEG-1, Lysine-rich CEACAM1 Co-isolated Protein, Metadherin, Metastasis Adhesion Protein, AEG1, LYRIC) (MaxLight 405) discontinued
Sign In for Pricing
View Details 