QKI Peptide - middle region
QKI Peptide - middle region
Product Specifications
Product Name Alternative
QK, Hqk, QK1, QK3, hqkI
UniProt
Q96PU8
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with QKI Rabbit Polyclonal Antibody (orb589785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006766.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![UBN1 (1-190) Mouse Monoclonal Antibody [Clone ID: UBN1-02]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fca39/imageurl/am26039pu-n.webp)
AM26039PU-N 100 µg
UBN1 (1-190) Mouse Monoclonal Antibody [Clone ID: UBN1-02]
Sign In for Pricing
View Details 
PKSM041336-01 10 µg
Recombinant Mouse Galectin 9/LGALS9 Protein (GST Tag)
Sign In for Pricing
View Details PKSM041336-02 50 µg
Recombinant Mouse Galectin 9/LGALS9 Protein (GST Tag)
Sign In for Pricing
View Details 
