HSPH1 Peptide - middle region
HSPH1 Peptide - middle region
Product Specifications
Product Name Alternative
HSP105, HSP105A, HSP105B, NY-CO-25
UniProt
Q92598
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPH1 Rabbit Polyclonal Antibody (orb589910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001273432.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
