Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK2 Rabbit Polyclonal Antibody (Biotin)

CDK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDKN2, p33 (CDK2)

UniProt

P24941

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, PPAP2A, LPP1) (HRP)
MBS6458322-01 0.2 mL

PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, PPAP2A, LPP1) (HRP)

Sign In for Pricing
View Details
PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, PPAP2A, LPP1) (HRP)
MBS6458322-02 5x 0.2 mL

PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, PPAP2A, LPP1) (HRP)

Sign In for Pricing
View Details
AMPD2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV667638 1.0 µg DNA

AMPD2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
FA13A Antibody
C40699-01 50 μL

FA13A Antibody

Sign In for Pricing
View Details
FA13A Antibody
C40699-02 100 µL

FA13A Antibody

Sign In for Pricing
View Details
Olr1482 (NM_001000026) Rat Tagged Lenti ORF Clone
RR201764L3 10 µg

Olr1482 (NM_001000026) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details