Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EHD3 Peptide - N-terminal region

EHD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAST3

UniProt

Q9NZN3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EHD3 Rabbit Polyclonal Antibody (orb589930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055415.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3112-3p mimic
HY-R03011-01 5 nmol

Mmu-miR-3112-3p mimic

Sign In for Pricing
View Details
Mmu-miR-3112-3p mimic
HY-R03011-02 20 nmol

Mmu-miR-3112-3p mimic

Sign In for Pricing
View Details
PABPCP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1585606 1.0 µg DNA

PABPCP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PLK1 Mouse Monoclonal Antibody [Clone ID: OTI8C12]
CF500393 100 µg

PLK1 Mouse Monoclonal Antibody [Clone ID: OTI8C12]

Sign In for Pricing
View Details
SETD3, CT (SETD3, C14orf154, Histone-lysine N-methyltransferase setd3, SET domain-containing protein 3) (PE) discontinued
041605-PE 200 µL

SETD3, CT (SETD3, C14orf154, Histone-lysine N-methyltransferase setd3, SET domain-containing protein 3) (PE) discontinued

Sign In for Pricing
View Details
ZNF462 polyclonal antibody
BS60800-01 50 µL

ZNF462 polyclonal antibody

Sign In for Pricing
View Details