Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDH1 Peptide - middle region

BDH1 Peptide - middle region

Product Specifications

Product Name Alternative

BDH, SDR9C1

UniProt

Q02338

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BDH1 Rabbit Polyclonal Antibody (orb589943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004042.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAH1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV626116 1.0 µg DNA

DNAH1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse mmu-miR-106b-5p miRNA Agomir
abx882684-01 5 nmol

Mouse mmu-miR-106b-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-106b-5p miRNA Agomir
abx882684-02 10 nmol

Mouse mmu-miR-106b-5p miRNA Agomir

Sign In for Pricing
View Details
MAPK12 ORF Vector (Human) (pORF)
ORF006260 1.0 µg DNA

MAPK12 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tubulin/MMP-IN-3
HY-172088 1 Each

Tubulin/MMP-IN-3

Sign In for Pricing
View Details
(Mouse) Bmi1 Antibody (Center)
MBS9201744-01 0.08 mL

(Mouse) Bmi1 Antibody (Center)

Sign In for Pricing
View Details