Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLB1 Peptide - C-terminal region

GLB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EBP, ELNR1, MPS4B

UniProt

P16278

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLB1 Rabbit Polyclonal Antibody (orb589776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000395.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sdr42e1 Mouse Gene Knockout Kit (CRISPR)
KN515442 1 Kit

Sdr42e1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3227), CF640R conjugate, 0.1mg/mL
BNC403227-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3227), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF647 conjugate, 0.1mg/mL
BNC472741-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COX4 (COX4I1) Rabbit Polyclonal Antibody
TA375014 100 µL

COX4 (COX4I1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3mC Recombinant Rabbit Monoclonal Antibody [PSH03-22]
HA721958 100 µL

3mC Recombinant Rabbit Monoclonal Antibody [PSH03-22]

Sign In for Pricing
View Details
NDUFA10 Human Gene Knockout Kit (CRISPR)
KN401572 1 Kit

NDUFA10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details