Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5R3 Peptide - middle region

CYB5R3 Peptide - middle region

Product Specifications

Product Name Alternative

B5R, DIA1

UniProt

P00387

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYB5R3 Rabbit Polyclonal Antibody (orb589954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000389.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itfg3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7137305 3x 1.0 µg

Itfg3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae bioB Protein (aa 1-332)
VAng-Lsx03104-1mgEcoli 1 mg (E. coli)

Recombinant Haemophilus Influenzae bioB Protein (aa 1-332)

Sign In for Pricing
View Details
ATG12 Rabbit Polyclonal Antibody (Cy3)
orb2589633 100 µg

ATG12 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Anti-C5aR [S5/1]
orb758946 0.2 mg

Anti-C5aR [S5/1]

Sign In for Pricing
View Details
SF3A3 (NM_006802) Human Recombinant Protein
PH40103M5 20 µg

SF3A3 (NM_006802) Human Recombinant Protein

Sign In for Pricing
View Details
IFITM5 Protein Vector (Mouse) (pPM-C-HA)
PV190712 500 ng

IFITM5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details