Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AVL9 Peptide - middle region

AVL9 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0241

UniProt

Q8NBF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055875.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kallikrein-15 (KLK15) AssayLite™ Antibody (PerCP Conjugate)
35623-05171 5x 30 µg

Human Kallikrein-15 (KLK15) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
Recombinant Escherichia coli zntB Protein (aa 1-327) (O1:K1)
VAng-Lsx03023-inquire Inquire

Recombinant Escherichia coli zntB Protein (aa 1-327) (O1:K1)

Sign In for Pricing
View Details
Zfp36l1 Rabbit Polyclonal Antibody (FITC)
orb2100870 100 µL

Zfp36l1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human DEFB110 siRNA
abx913890-01 15 nmol

Human DEFB110 siRNA

Sign In for Pricing
View Details
Human DEFB110 siRNA
abx913890-02 30 nmol

Human DEFB110 siRNA

Sign In for Pricing
View Details
Egr1 3'UTR Luciferase Stable Cell Line
TU203839 1.0 mL

Egr1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details