Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp36l1 Rabbit Polyclonal Antibody (FITC)

Zfp36l1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Brf, Brf1, ERF1, TIS1, cMG1, Berg36, TIS11b, AW742437, AW743212, D530020L18Rik

UniProt

P23950

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PMSESPHMFDSPPSPQDSLSDHEGYLSSSSSSHSGSDSPTLDNSRRLPIF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azurocidin/HBP Monoclonal Antibody, FITC Conjugated
bsm-41704M-FITC 100 µL

Azurocidin/HBP Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
MPHOSPH9 (M-phase Phosphoprotein 9, MPP9)
129808 100 µg

MPHOSPH9 (M-phase Phosphoprotein 9, MPP9)

Sign In for Pricing
View Details
MYZAP Protein Lysate (Rat) with C-HA Tag
31346036 100 µg

MYZAP Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
RFP (5H7) Monoclonal Antibody, FITC Conjugated
bsm-33181M-FITC 100 µL

RFP (5H7) Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
RNU7-14P Adenovirus (Human)
40523051 1.0 mL

RNU7-14P Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transcriptional regulator sarA (sarA)
MBS1291365-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Transcriptional regulator sarA (sarA)

Sign In for Pricing
View Details