Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA2D3 Peptide - middle region

CACNA2D3 Peptide - middle region

Product Specifications

Product Name Alternative

HSA272268

UniProt

Q8IZS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant beta actin Monoclonal Antibody
AN004840L-01 25 µL

Recombinant beta actin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant beta actin Monoclonal Antibody
AN004840L-02 100 µL

Recombinant beta actin Monoclonal Antibody

Sign In for Pricing
View Details
(D) - (-) -O-Acetylmandelic acid
OR18839-01 25 g

(D) - (-) -O-Acetylmandelic acid

Sign In for Pricing
View Details
(D) - (-) -O-Acetylmandelic acid
OR18839-02 100 g

(D) - (-) -O-Acetylmandelic acid

Sign In for Pricing
View Details
(D) - (-) -O-Acetylmandelic acid
OR18839-03 500 g

(D) - (-) -O-Acetylmandelic acid

Sign In for Pricing
View Details
E1A (GFP-Puro) Lentivirus
LVP1137-GP 1 x 10^7 IFU/mL - 200 µL

E1A (GFP-Puro) Lentivirus

Sign In for Pricing
View Details