Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKX Peptide - middle region

PRKX Peptide - middle region

Product Specifications

Product Name Alternative

PKX1

UniProt

O43930

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005035.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL
BNC680296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ginsenoside C-K
TRC-G410280-50MG 50 mg

Ginsenoside C-K

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705568 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Urolithin M7
TRC-U847045-25MG 25 mg

Urolithin M7

Sign In for Pricing
View Details
Oleyl Acetate
TRC-O532990-250MG 250 mg

Oleyl Acetate

Sign In for Pricing
View Details
TWIST2 antibody
FNab09119 100 µg

TWIST2 antibody

Sign In for Pricing
View Details