Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZPR1 Peptide - middle region

ZPR1 Peptide - middle region

Product Specifications

Product Name Alternative

ZNF259

UniProt

O75312

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003895.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lsm14a Rat shRNA Lentiviral Particle (Locus ID 361554)
TL708426V 500 µL Each

Lsm14a Rat shRNA Lentiviral Particle (Locus ID 361554)

Sign In for Pricing
View Details
Anti Human CD64 Flow Cytometry Monoclonal Clone 101 APC Ready To Use 100 Tests
IMSAHUCD64101CAPC100 100 Tests

Anti Human CD64 Flow Cytometry Monoclonal Clone 101 APC Ready To Use 100 Tests

Sign In for Pricing
View Details
PTPD1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2467849 100 µL

PTPD1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
PPL Antibody (C-term)
orb32284-01 50 µL

PPL Antibody (C-term)

Sign In for Pricing
View Details
PPL Antibody (C-term)
orb32284-02 100 µL

PPL Antibody (C-term)

Sign In for Pricing
View Details
Ack1 inhibitor 1
HY-149989 1 Each

Ack1 inhibitor 1

Sign In for Pricing
View Details