Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM2 Peptide - middle region

IFITM2 Peptide - middle region

Product Specifications

Product Name Alternative

1-8D, DSPA2c

UniProt

Q01629

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006426.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD73/NT5E Protein (His Tag)
PKSM041234-01 10 µg

Recombinant Mouse CD73/NT5E Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD73/NT5E Protein (His Tag)
PKSM041234-02 50 µg

Recombinant Mouse CD73/NT5E Protein (His Tag)

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-314
BCPS-314 1 Unit

Large Capacity Water Purification System BCPS-314

Sign In for Pricing
View Details
PICK1 (N-term) Rabbit Polyclonal Antibody
AP13655PU-N 400 µL

PICK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tiglyl Glycine
TRC-T440100-250MG 250 mg

Tiglyl Glycine

Sign In for Pricing
View Details
Choline Acetyltransferase Recombinant Rabbit monoclonal Antibody [JA67-11]
ET1704-16-50UL 50 µL

Choline Acetyltransferase Recombinant Rabbit monoclonal Antibody [JA67-11]

Sign In for Pricing
View Details