Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81 Peptide - middle region

CD81 Peptide - middle region

Product Specifications

Product Name Alternative

S5.7, CVID6, TAPA1, TSPAN28

UniProt

P60033

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001284578.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ApoA4 Protein (His Tag)
PDMH100325-01 20 µg

Recombinant Human ApoA4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ApoA4 Protein (His Tag)
PDMH100325-02 100 µg

Recombinant Human ApoA4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ApoA4 Protein (His Tag)
PDMH100325-03 500 µg

Recombinant Human ApoA4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ApoA4 Protein (His Tag)
PDMH100325-04 1 mg

Recombinant Human ApoA4 Protein (His Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR566332 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Mouse Bglap3 activation kit by CRISPRa
GA200401 1 Kit

Mouse Bglap3 activation kit by CRISPRa

Sign In for Pricing
View Details