Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Peptide - middle region

MCM3 Peptide - middle region

Product Specifications

Product Name Alternative

HCC5, P1.h, RLFB, P1-MCM3

UniProt

P25205

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257401.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULfatase 1 (SULF1) Human Gene Knockout Kit (CRISPR)
KN416632 1 Kit

SULfatase 1 (SULF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SRC Rabbit Polyclonal Antibody
TA385316 100 µL

SRC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(Z)-11-Octadecenoic Acid (Solution in Ethanol)
TRC-O860075-50MG 50 mg

(Z)-11-Octadecenoic Acid (Solution in Ethanol)

Sign In for Pricing
View Details
Human C16orf82 activation kit by CRISPRa
GA116040 1 Kit

Human C16orf82 activation kit by CRISPRa

Sign In for Pricing
View Details
B-AP15
SIH-339-5MG 5 mg

B-AP15

Sign In for Pricing
View Details
Wheat Germ Agglutinin, CF®568 Conjugate
#29077-1 1x 1 mg

Wheat Germ Agglutinin, CF®568 Conjugate

Sign In for Pricing
View Details