Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLUL Peptide - C-terminal region

GLUL Peptide - C-terminal region

Product Specifications

Product Name Alternative

GS, GLNS, PIG43, PIG59

UniProt

P15104

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028216.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRIP3 Protein Vector (Human) (pPM-C-HA)
PV070823 500 ng

CRIP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
KLRK1 Peptide - C-terminal region
orb2008107 100 µg

KLRK1 Peptide - C-terminal region

Sign In for Pricing
View Details
ZIC4 Antibody - middle region : Biotin (ARP39681_P050-Biotin)
ARP39681_P050-Biotin 100 µL

ZIC4 Antibody - middle region : Biotin (ARP39681_P050-Biotin)

Sign In for Pricing
View Details
Eif3f Antibody
orb854125 2 mg

Eif3f Antibody

Sign In for Pricing
View Details
Anti-Zebrafish MAO Antibody Picoband® Fluoro550 Conjugated
AZQ6NSN2-Fluoro550 100 µg/Vial

Anti-Zebrafish MAO Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
ADPRHL1 (NM_138430) Human Tagged ORF Clone
RC215044 10 µg

ADPRHL1 (NM_138430) Human Tagged ORF Clone

Sign In for Pricing
View Details