Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRK1 Peptide - C-terminal region

KLRK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD314, D12S2489E, FLJ17759, FLJ75772, KLR, NKG2-D, NKG2D

UniProt

P26718

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLRK1 Rabbit Polyclonal Antibody (orb585587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031386

Preservative

Lyophilized powder

AA Sequence

HIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPS9 Antibody
NBP2-22298 100 µL

Rabbit Polyclonal RPS9 Antibody

Sign In for Pricing
View Details
GOLT1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0883308 1.0 µg DNA

GOLT1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
AMD Factor V R2 Polymorphism PCR Detection Kit
KD6466232-100 100 Reactions

AMD Factor V R2 Polymorphism PCR Detection Kit

Sign In for Pricing
View Details
Temazepam (1.0 mg/mL in Methanol) discontinued
166697 10x1mL

Temazepam (1.0 mg/mL in Methanol) discontinued

Sign In for Pricing
View Details
Human c-fos (c-fos) ELISA Kit
YLA0586HU-01 48 Tests

Human c-fos (c-fos) ELISA Kit

Sign In for Pricing
View Details
Human c-fos (c-fos) ELISA Kit
YLA0586HU-02 96 Tests

Human c-fos (c-fos) ELISA Kit

Sign In for Pricing
View Details