What is the catalog number for RPAP3 Peptide - middle region?

The catalog number for RPAP3 Peptide - middle region is orb1999148.

What sizes are available for RPAP3 Peptide - middle region?

RPAP3 Peptide - middle region is available in the following size(s): 100 µg.

Is RPAP3 Peptide - middle region in stock?

RPAP3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RPAP3 Peptide - middle region

Product Specifications

UniProt

Q9H6T3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139547.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HESLSQESESEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2005334 100 µg

PCED1B Peptide - C-terminal region

Sign In for Pricing

View Details

TA502364 100 µL

OGFOD1 Mouse Monoclonal Antibody [Clone ID: OTI1F4]

Sign In for Pricing

View Details

H07345 1 g

L-Homocitrulline 98%

Sign In for Pricing

View Details

PA8205-01 50 μL

Rabbit Anti-Human ABI3BP pAb

Sign In for Pricing

View Details

PA8205-02 100 μL

Rabbit Anti-Human ABI3BP pAb

Sign In for Pricing

View Details

ARP39574_P050-25UL 25 µL

Foxl2 Antibody - C-terminal region

Sign In for Pricing

View Details