Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCED1B Peptide - C-terminal region

PCED1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM113B

UniProt

Q96HM7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCED1B Rabbit Polyclonal Antibody (orb326978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612380

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQANRNHPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Bromo-3-methoxycyclohexane
ILC93393-01 50 mg

1-Bromo-3-methoxycyclohexane

Sign In for Pricing
View Details
1-Bromo-3-methoxycyclohexane
ILC93393-02 0.5 g

1-Bromo-3-methoxycyclohexane

Sign In for Pricing
View Details
IMP5 discontinued
510655 100 µg

IMP5 discontinued

Sign In for Pricing
View Details
Mouse Pus1 activation kit by CRISPRa
GA205922 1 Kit

Mouse Pus1 activation kit by CRISPRa

Sign In for Pricing
View Details
HSPA12B Human shRNA Lentiviral Particle (Locus ID 116835)
TL304025V 500 µL Each

HSPA12B Human shRNA Lentiviral Particle (Locus ID 116835)

Sign In for Pricing
View Details
Recombinant Human LIMP-2/LIMPII Protein (His Tag)
PKSH033537-01 10 µg

Recombinant Human LIMP-2/LIMPII Protein (His Tag)

Sign In for Pricing
View Details