Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM162A Peptide - middle region

FAM162A Peptide - middle region

Product Specifications

Product Name Alternative

E2IG5, HGTD-P, C3orf28

UniProt

Q96A26

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055182.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3Beta,17Beta-Androst-5-enediol
TRC-A637670-2.5G 2.5 g

3Beta,17Beta-Androst-5-enediol

Sign In for Pricing
View Details
NGLY1 (NM_018297) Human Recombinant Protein
TP303447L 1 mg

NGLY1 (NM_018297) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human GPD1/GDP-C Protein (Human Cells, His Tag)
PKSH032505-01 10 µg

Recombinant Human GPD1/GDP-C Protein (Human Cells, His Tag)

Sign In for Pricing
View Details
Recombinant Human GPD1/GDP-C Protein (Human Cells, His Tag)
PKSH032505-02 50 µg

Recombinant Human GPD1/GDP-C Protein (Human Cells, His Tag)

Sign In for Pricing
View Details
ETFBKMT (NM_001135863) Human Over-expression Lysate
LC427724 20 µg

ETFBKMT (NM_001135863) Human Over-expression Lysate

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A3]
TA807644BM 100 µL

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A3]

Sign In for Pricing
View Details