Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEH1L Peptide - middle region

SEH1L Peptide - middle region

Product Specifications

Product Name Alternative

Seh1, SEH1A, SEH1B, SEC13L

UniProt

Q96EE3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001013455.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rack 13 boxes 50mm, 720x83x83mm, w/spring lock, fixed handle
TE24494FHB 1 Piece

Rack 13 boxes 50mm, 720x83x83mm, w/spring lock, fixed handle

Sign In for Pricing
View Details
SIKE HDR Plasmid (m)
sc-426123-HDR 20 µg

SIKE HDR Plasmid (m)

Sign In for Pricing
View Details
UBE3A Protein Vector (Mouse) (pPB-C-His)
PV243666 500 ng

UBE3A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Bisphenol A Bissulfate Disodium Salt-13C12
162902 2.5 mg

Bisphenol A Bissulfate Disodium Salt-13C12

Sign In for Pricing
View Details
LentimiRa-mmu-miR-350-3p Vector
mm40396 500 ng

LentimiRa-mmu-miR-350-3p Vector

Sign In for Pricing
View Details
Synuclein-pan (A19) polyclonal antibody
BS1349-01 50 µL

Synuclein-pan (A19) polyclonal antibody

Sign In for Pricing
View Details