What is the catalog number for SDAD1 Peptide - C-terminal region?

The catalog number for SDAD1 Peptide - C-terminal region is orb1999066.

What sizes are available for SDAD1 Peptide - C-terminal region?

SDAD1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is SDAD1 Peptide - C-terminal region in stock?

SDAD1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

SDAD1 Peptide - C-terminal region

Product Specifications

UniProt

Q9NVU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275912.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRYSQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb16849 100 µg

ZNF217 Immunizing Peptide

Sign In for Pricing

View Details

7117 20 µL

AAV-CMV-GFP (AAV serotype 9-DJ) AAV (AAV9/DJ-eGFP)

Sign In for Pricing

View Details

GTR15204395 1 Vial

Lentiviral mouse Snrnp70 shRNA (UAS) - Lentiviral mouse Snrnp70 shRNA (UAS, RFP) (25)

Sign In for Pricing

View Details

HY-P2052 1 Each

AWL 60

Sign In for Pricing

View Details

OR81759-01 100 mg

5',5'''-Bis (4-carboxyphenyl) [1,1':3',1'':4'',1''':3''',1''''-quinquephenyl]-4,4''''-dicarboxylic acid

Sign In for Pricing

View Details

OR81759-02 1 g

5',5'''-Bis (4-carboxyphenyl) [1,1':3',1'':4'',1''':3''',1''''-quinquephenyl]-4,4''''-dicarboxylic acid

Sign In for Pricing

View Details